Protein coding transcript 249289

• Transcript: Ll_transcript_31860
• CDS coordinates: 283-654 (+)
• Peptide sequence: MAASAAASLTGASASDLLRSSTSGFSGVPLRTLGSASLALKARGFAVSCKLRKVKKHEYPWPDNPDPNVKGGVLSHLSPFKPLREKPKPVTLEFEKPLLDLQKKIIDVIFSVFCVCFVHLSKY*
• ORF Type: complete

Annotations of Ll_transcript_31860

• Blastp: Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, chloroplastic from Pisum with 66.36% of identity
• Blastx: Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, chloroplastic from Pisum with 68.09% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019412958.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;