Protein coding transcript 249290

• Transcript: Ll_transcript_31861
• CDS coordinates: 3-386 (+)
• Peptide sequence: GFPIVTFIDTPGAYADLKSEEKGQGEAIAHNLRSMFGLKVPVVSIVIGEGGSGGALAIGCANKLLMLENAVFYVASPEACAAILWKSAKAAPKAAEKLKITATELCKLEVADGVIPVITLLIRAFSY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_31861

• Blastp: Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, chloroplastic from Arabidopsis with 87.07% of identity
• Blastx: Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, chloroplastic from Arabidopsis with 87.07% of identity
• Eggnog: Component of the acetyl coenzyme A carboxylase (ACC) complex. First, biotin carboxylase catalyzes the carboxylation of biotin on its carrier protein (BCCP) and then the CO(2) group is transferred by the carboxyltransferase to acetyl-CoA to form malonyl-CoA (By similarity)(COG0825)
• Kegg: Link to kegg annotations (AT2G38040)
• CantataDB: Link to cantataDB annotations (CNT0002886)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019412958.1)
• Pfam: Carboxyl transferase domain (PF01039.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;