Transcript | Ll_transcript_31864 |
---|---|
CDS coordinates | 1-390 (+) |
Peptide sequence | FIDTPGAYADLKSEELGQGEAIAHNLRSMFGLKVPVVSIVIGEGGSGGALAIGCANKLLMLENAVFYVASPEACAAILWKSAKAAPKAAEKLKITASELCRLEVADGVIPEPLGGAHADSAWTSQQIKNA |
ORF Type | internal |
Blastp | Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, chloroplastic from Arabidopsis with 86.72% of identity |
---|---|
Blastx | Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, chloroplastic from Arabidopsis with 86.72% of identity |
Eggnog | Component of the acetyl coenzyme A carboxylase (ACC) complex. First, biotin carboxylase catalyzes the carboxylation of biotin on its carrier protein (BCCP) and then the CO(2) group is transferred by the carboxyltransferase to acetyl-CoA to form malonyl-CoA (By similarity)(COG0825) |
Kegg | Link to kegg annotations (AT2G38040) |
CantataDB | Link to cantataDB annotations (CNT0002886) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019450295.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer