Protein coding transcript 249322

• Transcript: Ll_transcript_31391
• CDS coordinates: 1-1002 (+)
• Peptide sequence: REPSSSTQSNEDRKVINSVSHSKEVPSSLNEDDFVEAAGLSENDKEIDDKISSPKVGDGETDMVSPPSPRGSLHGENSKKKLRQPKKKDSSAKEVAAMDVPQKVYEEISDSEAKPTKRSAKQALGRTSNVKKNTVVNSVKKGNETASEPDARKHPSKKTEDGSKSGGRSDKKRHGRGKANSESGEEKSPVKDVDKELVSLSKTNTKSIKDEDSEELPKTNLKRKRTPGKGNESGTKKDGENLVGTRVKVWWPDDDMFYKGVIEYFIPAKKMHQVTYDDGDIEILNLQNETWEIITVGADSDGEEGADHPSPNVSADMHKKKKGKTSTSDPKTGG
• ORF Type: internal

Annotations of Ll_transcript_31391

• Blastp: Protein EMSY-LIKE 3 from Arabidopsis with 31.07% of identity
• Blastx: Protein EMSY-LIKE 3 from Arabidopsis with 31.07% of identity
• Eggnog: Chromosome 11 open reading frame 30(ENOG410YF3T)
• Kegg: Link to kegg annotations (AT5G13020)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438790.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;