Protein coding transcript 249388

• Transcript: Ll_transcript_32825
• CDS coordinates: 320-1252 (+)
• Peptide sequence: MALFPANFAFRFFLFCIILSLGFILTCGLLVWILSRILGASVGFRVGGCNSLRDVIVKFKKGAVESVSIGEIKLSLCHASINLGVGFSYWDPKLQLLICNLEVVMGPSSKSPGKKKTRKSRTRVLSRGKWIIIGNIARCLSVCLRDLVLKTPKCTVQIRQLNVDISKDGGCNSDLSVTVQIFPIVVHIGEPRVSCDQSSNFSGGGCSASSQASIAAIEKSSAPFICEKFSVSCEFGHDRGAGLLIKDVDILCGEVSVNLNDGLFVKRKSSLESPGSDRKIGTSADSTTTKQPSKKQQALASFSSMFPEKV*
• ORF Type: complete

Annotations of Ll_transcript_32825

• Blastp: Protein SABRE from Arabidopsis with 46.33% of identity
• Blastx: Protein SABRE from Arabidopsis with 44.78% of identity
• Eggnog: UPF0378 protein(ENOG410XSYR)
• Kegg: Link to kegg annotations (AT1G58250)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460716.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;