Protein coding transcript 2494

• Transcript: Ll_transcript_524836
• CDS coordinates: 1-522 (+)
• Peptide sequence: IMNPGWSLGWTWAKKEIIWAMMGAQAKEQGNCAKFKLKIPHSCKRNPEVVDLLPGAPYNMQYTNCCKGGVLTSWGQDPTGAVSAFQLGVGLSGTSNKTVKLPNNFKLMGPGPGYSCGPAKKVPATVMFTDDRRRKTQALMSWNVTCTYSQFLAYKNPSCCVSLSAFYNEQVTPC
• ORF Type: internal

Annotations of Ll_transcript_524836

• Blastp: COBRA-like protein 4 from Arabidopsis with 71.84% of identity
• Blastx: COBRA-like protein 4 from Arabidopsis with 71.84% of identity
• Eggnog: cobra-like protein(ENOG410YAAC)
• Kegg: Link to kegg annotations (AT5G15630)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435226.1)
• Pfam: COBRA-like protein (PF04833.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;