Protein coding transcript 249402

• Transcript: Ll_transcript_31153
• CDS coordinates: 587-904 (+)
• Peptide sequence: MPPIPRKWKGMCQSGHAFNSSNCNRKLIGARYFTKGHLAVSPSRIPEYLSPRDSSGHGTHTSSTAGGVPVPMASVLGYAEGVARGMAPGAHIAMYKVCWFNGSIT*
• ORF Type: complete

Annotations of Ll_transcript_31153

• Blastp: Subtilisin-like protease SBT1.2 from Arabidopsis with 69.16% of identity
• Blastx: Subtilisin-like protease SBT1.2 from Arabidopsis with 70.97% of identity
• Eggnog: peptidase (S8 and S53, subtilisin, kexin, sedolisin(COG1404)
• Kegg: Link to kegg annotations (AT1G04110)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444439.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;