Protein coding transcript 249416

• Transcript: Ll_transcript_30584
• CDS coordinates: 262-579 (+)
• Peptide sequence: MGDIVRLVEEAQSRETPVQRLADKVAGHFTYGVMAVSFTTFTFWSLFGTNILHASLYQGSAISLALQLACSVLVIACPCALGLATPTAVLVGTSLGATKGLLLRGG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_30584

• Blastp: Copper-transporting ATPase PAA1, chloroplastic from Arabidopsis with 76.42% of identity
• Blastx: Copper-transporting ATPase PAA1, chloroplastic from Arabidopsis with 78.18% of identity
• Eggnog: p-type ATPase(COG2217)
• Kegg: Link to kegg annotations (AT4G33520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461311.1)
• Pfam: E1-E2 ATPase (PF00122.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;