Protein coding transcript 24942

• Transcript: Ll_transcript_390448
• CDS coordinates: 477-1184 (+)
• Peptide sequence: MSWSPHMEVHYNNISYPYNTAGSFIEYFEGLTYEHANFIFSGASHAQESSYPSTSSFYKFGQGYDVNHHESLVNEYKRPLENSPSTNEQISAASTQWEECVNTDTQDNAIECPRRHHSNSNDYQVIWQDNIDPDDMTYEELLELGEAVGTQSRGLTQEQISLLPVSKYKCGFFFRKKSQDERCVICQMKYKRGEKRISLPCKHIYHTSCGNKWLSINKACPICYREVFADKSKHN*
• ORF Type: complete

Annotations of Ll_transcript_390448

• Blastp: E3 ubiquitin ligase BIG BROTHER from Arabidopsis with 43.09% of identity
• Blastx: E3 ubiquitin ligase BIG BROTHER from Arabidopsis with 43.39% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT3G63530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448595.1)
• Pfam: Ring finger domain (PF13639.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;