Transcript | Ll_transcript_390423 |
---|---|
CDS coordinates | 1414-1830 (+) |
Peptide sequence | MFAHDLTTFVSFLSGPRRQHSNSNDYQVIWQDNIDPDDMTYEELLELGEAVGTQSRGLTQEQISLLPVSKYKCGFFLRRKSRDERCVICQMEYKRGDKRISLPCKHIYHASCGNKWLSINKACPVCYTEVFADKSKHT* |
ORF Type | complete |
Blastp | E3 ubiquitin ligase BIG BROTHER from Arabidopsis with 64.86% of identity |
---|---|
Blastx | E3 ubiquitin ligase BIG BROTHER from Arabidopsis with 64.86% of identity |
Eggnog | zinc ion binding(ENOG41121N2) |
Kegg | Link to kegg annotations (AT3G63530) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448595.1) |
Pfam | RING-H2 zinc finger domain (PF12678.6) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer