Protein coding transcript 249487

• Transcript: Ll_transcript_30476
• CDS coordinates: 286-678 (+)
• Peptide sequence: MANQGSNEGSSSGNISAESLDSTLQLNIKTLDSRMYSFQVDTNMSVSSFKEKIANEIGVPVNQQRLIFRGKVLKDEHILSEYRILEIVDYFFIRFIFSGHGCFLILSFRMICLSCKLSALCTYLLFIQLP*
• ORF Type: complete

Annotations of Ll_transcript_30476

• Blastp: Large proline-rich protein BAG6 from Mus with 42.86% of identity
• Blastx: Large proline-rich protein BAG6 from Ornithorhynchus with 44.26% of identity
• Eggnog: tail-anchored membrane protein insertion into ER membrane(ENOG410XS9P)
• Kegg: Link to kegg annotations (224727)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453371.1)
• Pfam: Ubiquitin-2 like Rad60 SUMO-like (PF11976.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;