Transcript | Ll_transcript_30453 |
---|---|
CDS coordinates | 1053-2045 (+) |
Peptide sequence | MANQGSNEGSSSGNISAESLDSTLQLNIKTLDSRMYSFQVDTNMSVSSFKEKIANEIGVPVNQQRLIFRGKVLKDEHILSEYHLENGHTLHLVERQPNQSQVSGTSSAEPTVTNANQGNDAVSVAPRNRVGQISHSVVLGTINVGEQGEGMVPDLSGVIGAVLNSIGIGGQSRNSVSNATQTSAPSGNETEGIHAGNQNLAGNQAQPGQAFRGQAFQSLPQLVQIPVPAGTIPIPSLNAPIPHSLTTLSEFINNMEHTLSQNGHRPNLSSTNHGGQRIELPTNAQGLPTVEALSAILRRTGQLLSDNTVAALCDICCHVKSYTDRKICVS* |
ORF Type | complete |
Blastp | Large proline-rich protein BAG6 from Mus with 40% of identity |
---|---|
Blastx | Large proline-rich protein BAG6 from Ornithorhynchus with 45% of identity |
Eggnog | tail-anchored membrane protein insertion into ER membrane(ENOG410XS9P) |
Kegg | Link to kegg annotations (224727) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453371.1) |
Pfam | Ubiquitin-2 like Rad60 SUMO-like (PF11976.7) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer