Protein coding transcript 2495

• Transcript: Ll_transcript_524731
• CDS coordinates: 3-422 (+)
• Peptide sequence: HTSRLLSLLTVLLWIFYRLHGTPKSIVSDQDPVFMSRFWKEFFKLQGTHICFSSTYHPETNGQIEVINHCLEGYLRCSTGEQPRGWFCFLHLAEYWHNSNKHSTTSMTSFMALYGRPPPSVRDYVHGGATATGLDALLT*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_524731

• Blastp: Transposon Tf2-9 polyprotein from Schizosaccharomyces with 35.71% of identity
• Blastx: Transposon Tf2-8 polyprotein from Schizosaccharomyces with 35.71% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPAC167.08)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450597.1)
• Pfam: Integrase core domain (PF00665.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;