Protein coding transcript 249575

• Transcript: Ll_transcript_30195
• CDS coordinates: 157-600 (+)
• Peptide sequence: MREILHIQAGQCGNQIGGKFWEVVCDEHGIDQSGNYVGNSHLQLERVNVYYNEASGGRYVPRAVLMDLEPGTMDSLRSGPYGKIFRPDNFVFGQNGAGNNWAKGHYTEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_30195

• Blastp: Tubulin beta-1 chain from Soja with 94.89% of identity
• Blastx: Tubulin beta-1 chain from Soja with 94.89% of identity
• Eggnog: protein polymerization(COG5023)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421160.1)
• Pfam: Tubulin/FtsZ family, GTPase domain (PF00091.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;