Protein coding transcript 249591

• Transcript: Ll_transcript_31762
• CDS coordinates: 340-1131 (+)
• Peptide sequence: MGLSLSLLLSAWKEIVTHSLFGLSFNISLGSKNSAVFLRTSSFKKRESETTITSSRFKGHRPEKVILERKVPYNKENNMYHESVSEELVLQHKPVPILSLPESVVFSSPRPVSELDAAATKLQKVYKSYRTRRNLADCAVVVEELWWKALDFAALKRSSVSFFDVEKQETAVSRWSRARTRAAKVGKGLSKDEKAQKLALQHWLEAIDPRHRYGHNLHMYYDIWFESQSTQPFFYWLDIGDGKEINLEKCPRSTLQRQCIKYLA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_31762

• Blastp: IQ domain-containing protein IQM4 from Arabidopsis with 60.54% of identity
• Blastx: IQ domain-containing protein IQM4 from Arabidopsis with 60.54% of identity
• Eggnog: Calmodulin-binding(ENOG410XYNX)
• Kegg: Link to kegg annotations (AT2G26190)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416831.1)
• Pfam: IQ calmodulin-binding motif (PF00612.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;