Protein coding transcript 249592

• Transcript: Ll_transcript_31763
• CDS coordinates: 401-853 (+)
• Peptide sequence: MVVLLVSMQKCAVDDDDPTFSETNSFIATNESQQIMGPTQTTSQSVSQTNTQVNNNDKEINNAPIDKVVEAHSAFDYSKRLSCKWSTGAGPRIGCVRDYPEHLQLRALEQVNLSPGPASARISSYGPIPSPRPSPNVRISPRLAYMGLPSP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_31763

• Blastp: IQ domain-containing protein IQM1 from Arabidopsis with 68.18% of identity
• Blastx: IQ domain-containing protein IQM1 from Arabidopsis with 68.18% of identity
• Eggnog: calmodulin-binding family(ENOG4111I0K)
• Kegg: Link to kegg annotations (AT4G33050)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416831.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;