Transcript | Ll_transcript_31771 |
---|---|
CDS coordinates | 337-966 (+) |
Peptide sequence | MGLSLSLLLSAWKEIVTHSLFGLSFNISLGSKNSAVFLRTSSFKKRESETTITSSRFKGHRPEKVILERKVPYNKENNMYHESVSEELVLQHKPVPILSLPESVVFSSPRPVSELDAAATKLQKVYKSYRTRRNLADCAVVVEELWWKALDFAALRRSSISFFDVQKQETAVSRWARARTRAAKVGKGLSKDDKAQKLALQHWLEAVSY* |
ORF Type | complete |
Blastp | IQ domain-containing protein IQM4 from Arabidopsis with 55.27% of identity |
---|---|
Blastx | IQ domain-containing protein IQM4 from Arabidopsis with 71.53% of identity |
Eggnog | Calmodulin-binding(ENOG410XYNX) |
Kegg | Link to kegg annotations (AT2G26190) |
CantataDB | Link to cantataDB annotations (CNT0000733) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416831.1) |
Pfam | IQ calmodulin-binding motif (PF00612.26) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer