Protein coding transcript 249665

• Transcript: Ll_transcript_32186
• CDS coordinates: 85-651 (+)
• Peptide sequence: MAAAEPGRKQGAMMAKGVQKTLSKTSMLGNFLPTGTLLTFEMVLPSIYKDGQCTHVQTIMINLLLALGSLSCFFFHFTDSFRGADGNVYYGFVTPKGLSVFKPGLTVEVPKDERFKVGFTDFVHAIMSMLVFVAIAFSDHRVTSCLFPGHEKDMEQVRDSFPLMVGIVCSSLFLVFPTSRRGIGLMSA*
• ORF Type: complete

Annotations of Ll_transcript_32186

• Blastp: Protein DMP8 from Arabidopsis with 66.49% of identity
• Blastx: Protein DMP8 from Arabidopsis with 56.79% of identity
• Eggnog: Protein of unknown function (DUF679)(ENOG410YB9S)
• Kegg: Link to kegg annotations (AT1G09157)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460425.1)
• Pfam: Protein of unknown function (DUF679) (PF05078.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;