Transcript | Ll_transcript_32186 |
---|---|
CDS coordinates | 85-651 (+) |
Peptide sequence | MAAAEPGRKQGAMMAKGVQKTLSKTSMLGNFLPTGTLLTFEMVLPSIYKDGQCTHVQTIMINLLLALGSLSCFFFHFTDSFRGADGNVYYGFVTPKGLSVFKPGLTVEVPKDERFKVGFTDFVHAIMSMLVFVAIAFSDHRVTSCLFPGHEKDMEQVRDSFPLMVGIVCSSLFLVFPTSRRGIGLMSA* |
ORF Type | complete |
Blastp | Protein DMP8 from Arabidopsis with 66.49% of identity |
---|---|
Blastx | Protein DMP8 from Arabidopsis with 56.79% of identity |
Eggnog | Protein of unknown function (DUF679)(ENOG410YB9S) |
Kegg | Link to kegg annotations (AT1G09157) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019460425.1) |
Pfam | Protein of unknown function (DUF679) (PF05078.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer