Transcript | Ll_transcript_524776 |
---|---|
CDS coordinates | 75-512 (+) |
Peptide sequence | MNDPGLNRLLQWSVQNSAASRNDPTTVQTDDVREPARALNPELLKQLMGGPSEADLMKQAMHAIVAPLDQCDLENKLIAWDNFEQLIEGIDNAKNMQPLGLWIPLVEQLDHEIPDMRAWAAHCLNTAVQNNPDCQERCLAINAIPK |
ORF Type | 3prime_partial |
Blastp | - |
---|---|
Blastx | Hsp70 nucleotide exchange factor fes1 from Aspergillus with 54.86% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AOR_1_120114) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_014517152.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer