Protein coding transcript 249740

• Transcript: Ll_transcript_30544
• CDS coordinates: 83-625 (+)
• Peptide sequence: MKFNIANPTTGCQKKLEIDDDLKLRAFWDKRISQEVLGDALGEEFKGYVFKITGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFRGYGRRTGERRRKSVRGCIVSPDLSVLNLVIVKKGDNDLPGLTDIEKPRMRGPKRASKIRKLFNLSKEDDVRNSFQPQRRCCWDPRIQYNNGGPMQ*
• ORF Type: complete

Annotations of Ll_transcript_30544

• Blastp: 40S ribosomal protein S6 from Asparagus with 85.64% of identity
• Blastx: 40S ribosomal protein S6 from Asparagus with 85.64% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431347.1)
• Pfam: Ribosomal protein S6e (PF01092.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;