Protein coding transcript 249762

• Transcript: Ll_transcript_32049
• CDS coordinates: 1-303 (+)
• Peptide sequence: ANHFHDCTTTEEKGRNMEIKAGLSALVTGAASGIGKSLVLALAEKGIFITLVDFSEEKGRELAALVQEINTKFHPNLDFPSALFFKCDVTNSSKLEFPAY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_32049

• Blastp: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] from Macaca with 41.33% of identity
• Blastx: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] from Macaca with 41.33% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422170.1)
• Pfam: short chain dehydrogenase (PF00106.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;