Protein coding transcript 249765

• Transcript: Ll_transcript_32054
• CDS coordinates: 444-1016 (+)
• Peptide sequence: MPCAFMTFGGYSEFIMINSKHALPVPRPDAEVVAMLTSGLTASIALEKAGAAKMESGKVVLVTAAAGGTGQFAVQLAKLAGNTVIATCGGGAKAKLLQELGVDRVIDYHSEDIKTVLMKEFPKGIDVIYESVGGDMLNLCLNALAVHGRLIVIGMISQYQGDSGWTPSKYPGLLEKLLAKSQTVAGFFLVQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_32054

• Blastp: Prostaglandin reductase-3 from Mus with 50.54% of identity
• Blastx: Prostaglandin reductase-3 from Bos with 48.51% of identity
• Eggnog: alcohol dehydrogenase(COG2130)
• Kegg: Link to kegg annotations (225791)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424213.1)
• Pfam: Zinc-binding dehydrogenase (PF00107.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;