Protein coding transcript 249766

• Transcript: Ll_transcript_32044
• CDS coordinates: 3-323 (+)
• Peptide sequence: IRGGRVILHPITSPPSEFANVEKGDALHAMELALSLEKLVNEKLLNLHSVAGRNNDPQLADFIESEFLNEQVEAIKKISEYVTQLRIVGKGHGVWHFNQKLLHGAE*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_32044

• Blastp: Ferritin-3, chloroplastic from Vigna with 85.44% of identity
• Blastx: Ferritin-3, chloroplastic from Vigna with 85.44% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000541)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446512.1)
• Pfam: Ferritin-like domain (PF00210.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;