Protein coding transcript 2498

• Transcript: Ll_transcript_524829
• CDS coordinates: 3-704 (+)
• Peptide sequence: TAGIDGLHFIARDITFQNTAGPLKGQAVALRSASDLSVFYRCAIAGYQDTLMVHAQRQFYRQCYIYGTVDFIFGNAAVVFQNCNIFARKPLDGQANMITAQGRGDPFQNSGISIHNCQIRAAPDLKPVVDKYNTFLGRPWQQYSRVVVMKTFMDTLVSPLGWSPWGDTDFAQDTLYYGEYENSGPGSSTSNRVKWPGYHVITSPDEASKFTVNALLAGGTWLPTTSVPFSSGI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_524829

• Blastp: Probable pectinesterase/pectinesterase inhibitor 59 from Arabidopsis with 67.09% of identity
• Blastx: Probable pectinesterase/pectinesterase inhibitor 59 from Arabidopsis with 67.09% of identity
• Eggnog: pectinesterase(COG4677)
• Kegg: Link to kegg annotations (AT5G51490)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457370.1)
• Pfam: Pectinesterase (PF01095.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;