Protein coding transcript 249801

• Transcript: Ll_transcript_31816
• CDS coordinates: 129-737 (+)
• Peptide sequence: MESALFRPCYVPLFLQPNDLRSNITSSIRYTSTIFCSSRNQSYIPKLEPFSRTKFDRIVKDPPLIQKSEKEIADYCSTLEGDECCSCWQAYFELKDLEKESPKADIEGLILQTGGIKSLIGCLHGVAIMHKMKNNKFNLPNNVKSESEAHKSYHIPDGLPKSVDELIEEEEARMPDSSYTRLLRTMGSFPAWYSPAPDHESD*
• ORF Type: complete

Annotations of Ll_transcript_31816

• Blastp: CCG-binding protein 1 from Arabidopsis with 54.85% of identity
• Blastx: CCG-binding protein 1 from Arabidopsis with 54.85% of identity
• Eggnog: NA(ENOG41123WT)
• Kegg: Link to kegg annotations (AT2G15890)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424239.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;