Transcript | Ll_transcript_31820 |
---|---|
CDS coordinates | 359-811 (+) |
Peptide sequence | MMFCWMRHWLTILMCFFYRFADYCSTLEGEECCSCWQAYFELKDLEKESPKADIERLILQTGGVKSLIGCLHGVAIMHKMKNNKLNLTKDVKSEEEPQRYFPIPDGLPKSSDELLEEEQAKMPDSPYTRLLRTMGSFPAWYSPAPDHETD* |
ORF Type | complete |
Blastp | CCG-binding protein 1 from Arabidopsis with 61.65% of identity |
---|---|
Blastx | CCG-binding protein 1 from Arabidopsis with 61.65% of identity |
Eggnog | NA(ENOG41123WT) |
Kegg | Link to kegg annotations (AT2G15890) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445760.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer