Protein coding transcript 249822

• Transcript: Ll_transcript_30012
• CDS coordinates: 2240-2728 (+)
• Peptide sequence: MGGTMRLGSRRTFFQTKECKSAKLYGCKGFIEERHRHRYEVNPDLVACLENAGLSFTGKDETGKRMEIVEVPNHPYFIGVQFHPEFKSRPGKPSPLFLGFIAAACGKLDNMLQHPSSVESNGLSKAVGTGVVSAVKAHNKKTAMKPAYRPEYVYGSCNGYHY*
• ORF Type: complete

Annotations of Ll_transcript_30012

• Blastp: CTP synthase 2 from Xenopus with 63.16% of identity
• Blastx: CTP synthase from Schizosaccharomyces with 52.71% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (444477)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446965.1)
• Pfam: Glutamine amidotransferase class-I (PF00117.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;