Protein coding transcript 249823

• Transcript: Ll_transcript_30013
• CDS coordinates: 3-461 (+)
• Peptide sequence: AIKIDPYLNTDAGTMSPFEHGEVFVLDDGGEVDLDLGNYERFMDIKLTRDNNITTGKIYQFVIDKERRGDYLGKTVQVVPHITDAIQEWIERVAHIPVDGKTGSADVCVIELGGTIGDIESMPFIQALGQFSYRVGESKFMNTMYESVFDLF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_30013

• Blastp: CTP synthase from Dictyostelium with 79.29% of identity
• Blastx: CTP synthase from Dictyostelium with 79.29% of identity
• Eggnog: Catalyzes the ATP-dependent amination of UTP to CTP with either L-glutamine or ammonia as the source of nitrogen (By similarity)(COG0504)
• Kegg: Link to kegg annotations (DDB_G0280567)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446966.1)
• Pfam: CTP synthase N-terminus (PF06418.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;