Protein coding transcript 2499

• Transcript: Ll_transcript_524814
• CDS coordinates: 32-475 (+)
• Peptide sequence: MSNPRVEEIVDDKPEQQVEVDDSSSDSEGEDGGIPAGSSVTVHSRNEKKARKAIAKLGLKKIEGITRVTLRRPKNILFVISQPDVYKSPNSNTYIIFGEAKIEDLNSQAQAAAAQQLSQQEGAAEHTHDHSDKGKAPEVEAKKEEEEE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_524814

• Blastp: Nascent polypeptide-associated complex subunit alpha from Aspergillus with 74.31% of identity
• Blastx: Nascent polypeptide-associated complex subunit alpha from Aspergillus with 72.9% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AOR_1_312114)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003602402.1)
• Pfam: NAC domain (PF01849.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;