Protein coding transcript 249907

• Transcript: Ll_transcript_32781
• CDS coordinates: 221-628 (+)
• Peptide sequence: MALLHSGAFSFRSLKFSHPSPSIKFTQYSVKASSFSSPLPSPLLRFNVTGKAIPGDRKGETKESALVVSFGEMLIDFVPTVNGVSLADAPAFKKAPGGAPANVAVGIARLGGSSAFIGKVLYEYFTMFFLHFSEI*
• ORF Type: complete

Annotations of Ll_transcript_32781

• Blastp: Probable fructokinase-6, chloroplastic from Arabidopsis with 68.04% of identity
• Blastx: Probable fructokinase-6, chloroplastic from Arabidopsis with 74.07% of identity
• Eggnog: pfkb domain protein(COG0524)
• Kegg: Link to kegg annotations (AT1G66430)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461633.1)
• Pfam: pfkB family carbohydrate kinase (PF00294.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;