Protein coding transcript 249930

• Transcript: Ll_transcript_30208
• CDS coordinates: 3-467 (+)
• Peptide sequence: EKHVWSDVHTLRPHGVVFSFLVSCRKHLLLAGICNFTNGSCFNLWKVDEKTMEFNEIGAMPHDLLYDLFDGDEDDKFASLKCVGLGDLIYVFNEDYHRVYPACLCEIDDESGKCSWRKVPQLPLPVNKFHKVITFCSTISLHSVLGQHQYLGLQ*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_30208

• Blastp: F-box/kelch-repeat protein At3g24760 from Arabidopsis with 56.46% of identity
• Blastx: F-box/kelch-repeat protein At3g24760 from Arabidopsis with 56.85% of identity
• Eggnog: F-box kelch-repeat protein(ENOG4111ZM5)
• Kegg: Link to kegg annotations (AT3G24760)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450188.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;