Protein coding transcript 249975

• Transcript: Ll_transcript_31004
• CDS coordinates: 145-636 (+)
• Peptide sequence: MQALAVLDLSCNMLSGPIPSILGNLSYTEKVYLHGNKLTGFIPPELGNMSKLHYLELNNNHLSGHIPPELGNLTDLFDLNVANNNLEGPIPDNLSSCKNLNSLNVHGNKLNGTIPPALKSLESMTYLNLSSNNLQGPIPIELSRIGNLDTLDISNNHIVGSIPS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_31004

• Blastp: LRR receptor-like serine/threonine-protein kinase ERECTA from Arabidopsis with 82.93% of identity
• Blastx: LRR receptor-like serine/threonine-protein kinase ERECTA from Arabidopsis with 82.87% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT2G26330)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434076.1)
• Pfam: Leucine rich repeat (PF13855.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;