Protein coding transcript 249987

• Transcript: Ll_transcript_31228
• CDS coordinates: 436-1296 (+)
• Peptide sequence: MAVGVVDGTSEAIFQTIMSLGPSRSEWDFCFHNGNVVEHLDGHTDIIHKQLYRDWLPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPPWKGYVRACLKSGGYVISPANKGKQSVVKHMLAIDWKFWRSYLKPSLAHSITIRMLGRVAALHELFRAKLGNCSSSGYSSGDLIRNSSPHLKERDITSESDTQIQAGDEKTHDNSVDEVDQTQSEHANLVSLNDADDEFYDVPEPSDCDESEYGWMAECSHQRSQVKNCLKWLLVLRRKEMNNPKSNVSLSFQN*
• ORF Type: complete

Annotations of Ll_transcript_31228

• Blastp: Protein ENHANCED DISEASE RESISTANCE 2-like from Arabidopsis with 45.62% of identity
• Blastx: Protein ENHANCED DISEASE RESISTANCE 2-like from Arabidopsis with 40.45% of identity
• Eggnog: Domain containing protein, expressed(ENOG4112846)
• Kegg: Link to kegg annotations (AT5G45560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447866.1)
• Pfam: START domain (PF01852.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;