Transcript | Ll_transcript_453198 |
---|---|
CDS coordinates | 3-944 (+) |
Peptide sequence | LLSTLTMASSLIQLHCSTLSLTSNPSILPPRPSVTSFLTKPIGKSRLQAHIPRQVFPVRALTYDGGFGSEDKASGSDDEVSGVAVVEEEKTEVEKVKKLLVDSLYGTDRGLRASRETRSEIVELITQLEALNPTPAPTQALPLLNGKWILAYTSFRGLFPLLSQAIAPFIRAGDISQTIDSETYAVQNSVQFVGPWTTTDVNCHGKYEVRSPKRVQLKIEERVIGTPQLTDSLTIPEEVEFVGQKIDLKPLKGILDEKAKKLSRKPPVRLPVPKPFAESWLLTTYLDEDIRVSRGDFGSVFVFFKEGSSFFTS* |
ORF Type | 5prime_partial |
Blastp | Chromoplast-specific carotenoid-associated protein, chromoplastic from Cucumis with 53.68% of identity |
---|---|
Blastx | Chromoplast-specific carotenoid-associated protein, chromoplastic from Cucumis with 52.96% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (101203857) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019425196.1) |
Pfam | PAP_fibrillin (PF04755.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer