| Transcript | Ll_transcript_524747 |
|---|---|
| CDS coordinates | 17-415 (+) |
| Peptide sequence | MGLARYNSAMIVIMLSFCMLVFNSEIAHAETYIVGDAAGWDNNKDVSSWSNGKQFKPGDKFVFKYKAEKHNVVKVPEIGYIACVNPIGNKDTPLLNSGNDVIILRNPGKHYFISSRYDDCQRQGMKIILNIL* |
| ORF Type | complete |
| Blastp | Chemocyanin from Lilium with 41.67% of identity |
|---|---|
| Blastx | Chemocyanin from Lilium with 41.67% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019455216.1) |
| Pfam | Plastocyanin-like domain (PF02298.16) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer