Transcript | Ll_transcript_32152 |
---|---|
CDS coordinates | 2556-2999 (+) |
Peptide sequence | MIRNVPYDWINNEKSNQHWLRKEGEKFLFPGGGTMFPNGVGEYVDLMVDLIPEMKDGTVRTAIDTGCGVASWGGDLLDRGILTISLAPRDNHEAQVQFALERGIPAMLGVISTQRLPYPSNSFDMAHCSRCLIPWTEFGNYSLDHEF* |
ORF Type | complete |
Blastp | Probable methyltransferase PMT21 from Arabidopsis with 88.65% of identity |
---|---|
Blastx | Probable methyltransferase PMT20 from Arabidopsis with 59.88% of identity |
Eggnog | Methyltransferase(ENOG4111CGI) |
Kegg | Link to kegg annotations (AT4G19120) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421310.1) |
Pfam | Putative S-adenosyl-L-methionine-dependent methyltransferase (PF03141.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer