Protein coding transcript 250047

• Transcript: Ll_transcript_31287
• CDS coordinates: 822-1160 (+)
• Peptide sequence: MRILILVRNFLPGYHQAVNGEWNVAGIAHRAYDLEGKTIGTVGAGRIGRLLLQRLKPFNCNLLYHDRLQLDPELENQLGAKYEEDLDAMLPKCDVLVINTPLTDKTRYNSVL*
• ORF Type: complete

Annotations of Ll_transcript_31287

• Blastp: Formate dehydrogenase 1, mitochondrial from Oryza sativa with 87.85% of identity
• Blastx: Formate dehydrogenase 1, mitochondrial from Oryza sativa with 87.34% of identity
• Eggnog: Dehydrogenase(COG1052)
• Kegg: Link to kegg annotations (4341069)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433138.1)
• Pfam: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain (PF02826.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;