Protein coding transcript 250048

• Transcript: Ll_transcript_31292
• CDS coordinates: 822-1490 (+)
• Peptide sequence: MRILILVRNFLPGYHQAVNGEWNVAGIAHRAYDLEGKTIGTVGAGRIGRLLLQRLKPFNCNLLYHDRLQLDPELENQLGAKYEEDLDAMLPKCDVLVINTPLTDKTRGLFDKNRIAKCKKGVLIVNNARGAIMDAQAVADASSSGHIAGYSGDVWFPQPAPKDHPWRYMPNHAMTPHISGTTIDAQLRYAAGVKDMLERHFKGEDFPEQHYIVKEGQLASQYR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_31292

• Blastp: Formate dehydrogenase 1, mitochondrial from Oryza sativa with 87.44% of identity
• Blastx: Formate dehydrogenase 1, mitochondrial from Oryza sativa with 87.25% of identity
• Eggnog: Dehydrogenase(COG1052)
• Kegg: Link to kegg annotations (4341069)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433134.1)
• Pfam: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain (PF02826.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;