Transcript | Ll_transcript_31292 |
---|---|
CDS coordinates | 822-1490 (+) |
Peptide sequence | MRILILVRNFLPGYHQAVNGEWNVAGIAHRAYDLEGKTIGTVGAGRIGRLLLQRLKPFNCNLLYHDRLQLDPELENQLGAKYEEDLDAMLPKCDVLVINTPLTDKTRGLFDKNRIAKCKKGVLIVNNARGAIMDAQAVADASSSGHIAGYSGDVWFPQPAPKDHPWRYMPNHAMTPHISGTTIDAQLRYAAGVKDMLERHFKGEDFPEQHYIVKEGQLASQYR |
ORF Type | 3prime_partial |
Blastp | Formate dehydrogenase 1, mitochondrial from Oryza sativa with 87.44% of identity |
---|---|
Blastx | Formate dehydrogenase 1, mitochondrial from Oryza sativa with 87.25% of identity |
Eggnog | Dehydrogenase(COG1052) |
Kegg | Link to kegg annotations (4341069) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433134.1) |
Pfam | D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain (PF02826.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer