Protein coding transcript 250110

• Transcript: Ll_transcript_32122
• CDS coordinates: 1156-2004 (+)
• Peptide sequence: MELCPAKLIGPMVPSAYLDGRIEGDKGYGASLWKPLGEECIKWLEAKAPKSVVYISFGSMVSLTKEQMEKVALGLKESGVSFLWVLRESEHCNLPHGYIDSIKEKGLIVTWCNQLELLANQAIGCFVTHCGWNSTLESLSLGVPVVCLPQWADQLPDAKFLEDVWEVGVRPKGDDKGVVRKQEFVESLKVVMEGKRSQEIRRNASKWKKLARDAVSEDGNSDKNINDFVNSLMNADNKRSQEIRRNASKWKKLARDAVSEDGNSDKNINDFVNSLMNADNKN*
• ORF Type: complete

Annotations of Ll_transcript_32122

• Blastp: UDP-glycosyltransferase 74E1 from Arabidopsis with 59.29% of identity
• Blastx: UDP-glycosyltransferase 74E1 from Arabidopsis with 57.63% of identity
• Eggnog: Transferase(COG1819)
• Kegg: Link to kegg annotations (AT1G05675)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420353.1)
• Pfam: UDP-glucoronosyl and UDP-glucosyl transferase (PF00201.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;