Protein coding transcript 250118

• Transcript: Ll_transcript_31568
• CDS coordinates: 896-1336 (+)
• Peptide sequence: MHVAERDVIQEMVRIVKKKPDPHVREKILILIDTWQEAFGGPRARYPQYYAAYQELLRAGAVFPQRSEQSAPVFTPLQTHPLASYPQNIRDSDARQGTAESSAESEFPTLSLTEIQNARGIMDVLSEMLNAIDPGNKEVSCSIQIS*
• ORF Type: complete

Annotations of Ll_transcript_31568

• Blastp: TOM1-like protein 9 from Arabidopsis with 78.26% of identity
• Blastx: TOM1-like protein 9 from Arabidopsis with 78.95% of identity
• Eggnog: gamma adaptin ear containing, arf binding protein(ENOG410Y26G)
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0001565)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417347.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;