Transcript | Ll_transcript_31564 |
---|---|
CDS coordinates | 999-1502 (+) |
Peptide sequence | MHVAERDVIQEMVRIVKKKPDPHVREKILILIDTWQEAFGGPRARYPQYYAAYQELLRAGAVFPQRSEQSAPVFTPLQTHPLASYPQNIRDSDARQGTAESSAESEFPTLSLTEIQNARGIMDVLSEMLNAIDPGNKEGLSQEVIVDLVEQCRTYKQRVVHLVNSTT* |
ORF Type | complete |
Blastp | TOM1-like protein 9 from Arabidopsis with 79.64% of identity |
---|---|
Blastx | TOM1-like protein 9 from Arabidopsis with 60.07% of identity |
Eggnog | gamma adaptin ear containing, arf binding protein(ENOG410Y26G) |
Kegg | - |
CantataDB | Link to cantataDB annotations (CNT0001565) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417347.1) |
Pfam | GAT domain (PF03127.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer