Protein coding transcript 250188

• Transcript: Ll_transcript_30907
• CDS coordinates: 831-1355 (+)
• Peptide sequence: MLVIDRENDRALLASRPKLIPRLWSCLAGFTEPGESLEEAVRRETLEETSIEVGEVVYHSSQPWPVGPNSIPCQLMVGFFAYAKSLEITVDKKELEDAQWYSREDVRKALTFGEYKKSQRNAAVKVEQMCKGVEKSQRLAADSNTESEELAPMFVPGPYAIAHHLISSWAFPDP*
• ORF Type: complete

Annotations of Ll_transcript_30907

• Blastp: Nudix hydrolase 19, chloroplastic from Arabidopsis with 74.14% of identity
• Blastx: Nudix hydrolase 19, chloroplastic from Arabidopsis with 71.81% of identity
• Eggnog: NADH pyrophosphatase(COG2816)
• Kegg: Link to kegg annotations (AT5G20070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464610.1)
• Pfam: NUDIX domain (PF00293.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;