Protein coding transcript 250195

• Transcript: Ll_transcript_30920
• CDS coordinates: 963-1469 (+)
• Peptide sequence: MEETGFDVSKLLNKDEYLEIIFGQQRVRLYIIAGVKDDTAFAPLTKKEISEIAWHRLDELQPASDDVISRGITGLKLYMVSPFLASLKSWISSHQPPMAPRLDLPLKGICVWKARNSPIGSSSMIIDSQPTKPEPDSHSIDVGPGRSFRNFKFDTASILQAMEAAFSS*
• ORF Type: complete

Annotations of Ll_transcript_30920

• Blastp: mRNA-decapping enzyme subunit 2 from Arabidopsis with 48.62% of identity
• Blastx: mRNA-decapping enzyme subunit 2 from Arabidopsis with 59.52% of identity
• Eggnog: Nudix hydrolase(COG0494)
• Kegg: Link to kegg annotations (AT5G13570)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449802.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;