Protein coding transcript 250201

• Transcript: Ll_transcript_30913
• CDS coordinates: 985-1326 (+)
• Peptide sequence: MEETGFDVSKLLHKDEYLEIIFGQQRVRLYIVAGVKDDTVFAPLTKKEISEIAWHRLDELQPASDDVISRGITGLKLYMVSPFLASLKSWISSHQPPMAPRPDLPLKGICVWKA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_30913

• Blastp: mRNA-decapping enzyme subunit 2 from Arabidopsis with 72.81% of identity
• Blastx: mRNA-decapping enzyme subunit 2 from Arabidopsis with 81.05% of identity
• Eggnog: Nudix hydrolase(COG0494)
• Kegg: Link to kegg annotations (AT5G13570)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413476.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;