Protein coding transcript 250215

• Transcript: Ll_transcript_32245
• CDS coordinates: 197-568 (+)
• Peptide sequence: MRRSSFSSKKTGQSNSDLYRSASSKASSKESERIDSLFYSYANGSTGLIDPEGIETLCADIEVDHTDVRILMLAWKMKSEEQGYFTLDEWRRGLKALRVDTVSKLKKALPDLENEVRRPTNFAD
• ORF Type: 3prime_partial

Annotations of Ll_transcript_32245

• Blastp: DCN1-like protein 4 from Homo with 42.39% of identity
• Blastx: DCN1-like protein 4 from Homo with 43.53% of identity
• Eggnog: DCN1, defective in cullin neddylation 1, domain containing(ENOG410XTIJ)
• Kegg: Link to kegg annotations (23142)
• CantataDB: Link to cantataDB annotations (CNT0000674)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429470.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;