Transcript | Ll_transcript_30242 |
---|---|
CDS coordinates | 125-643 (+) |
Peptide sequence | MWRCVARGLGAPATSTRSTPSSLISRFFSSDVKSSYTVVDHKYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQVVTIKGDNPDAIVPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVSEIHRPGEKQKPLEKDAGQKTIAWLDKLRNSNGSLP |
ORF Type | 3prime_partial |
Blastp | Succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial from Arabidopsis with 84.69% of identity |
---|---|
Blastx | Succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial from Arabidopsis with 84.69% of identity |
Eggnog | Succinate DeHydrogenase(COG1053) |
Kegg | Link to kegg annotations (AT5G66760) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421070.1) |
Pfam | FAD binding domain (PF00890.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer