Protein coding transcript 250284

• Transcript: Ll_transcript_30242
• CDS coordinates: 125-643 (+)
• Peptide sequence: MWRCVARGLGAPATSTRSTPSSLISRFFSSDVKSSYTVVDHKYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQVVTIKGDNPDAIVPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVSEIHRPGEKQKPLEKDAGQKTIAWLDKLRNSNGSLP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_30242

• Blastp: Succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial from Arabidopsis with 84.69% of identity
• Blastx: Succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial from Arabidopsis with 84.69% of identity
• Eggnog: Succinate DeHydrogenase(COG1053)
• Kegg: Link to kegg annotations (AT5G66760)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421070.1)
• Pfam: FAD binding domain (PF00890.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;