Protein coding transcript 250296

• Transcript: Ll_transcript_30250
• CDS coordinates: 125-598 (+)
• Peptide sequence: MWRCVARGLGAPATSTRSTPSSLISRFFSSDVKSSYTVVDHKYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQVVTIKGDNPDAIVPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVSEIHRPGMILFQLLKIVVPI*
• ORF Type: complete

Annotations of Ll_transcript_30250

• Blastp: Succinate dehydrogenase [ubiquinone] flavoprotein subunit 2, mitochondrial from Arabidopsis with 74.03% of identity
• Blastx: Succinate dehydrogenase [ubiquinone] flavoprotein subunit 2, mitochondrial from Arabidopsis with 74.03% of identity
• Eggnog: Succinate DeHydrogenase(COG1053)
• Kegg: Link to kegg annotations (AT2G18450)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421070.1)
• Pfam: FAD binding domain (PF00890.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;