Protein coding transcript 250490

• Transcript: Ll_transcript_32538
• CDS coordinates: 1-351 (+)
• Peptide sequence: WTAWAYKPRTITLLHIGACFLIWASGALDPERDASGDLVTSVKRGVWAMIAVFLAYCLLQAPSTVLIRPHPAIWRLVHGMAVVYLVALTFLLFQKRDDARQFMKYLHPDLGVGNSI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_32538

• Blastp: CDP-diacylglycerol--serine O-phosphatidyltransferase 1 from Arabidopsis with 89.29% of identity
• Blastx: CDP-diacylglycerol--serine O-phosphatidyltransferase 1 from Arabidopsis with 62.16% of identity
• Eggnog: Phosphatidylserine synthase(ENOG410XS7H)
• Kegg: Link to kegg annotations (AT1G15110)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426523.1)
• Pfam: Phosphatidyl serine synthase (PF03034.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;