Transcript | Ll_transcript_32541 |
---|---|
CDS coordinates | 115-486 (+) |
Peptide sequence | MNDLFLFYFGCYSSWASGALDPERDASGDLVTSVKRGVWAMIAVFLAYCLLQAPSTVLIRPHPAIWRLVHGMAVVYLVALTFLLFQKRDDARQFMKYLHPDLGVELPERSYGADCRLYLADNPT |
ORF Type | 3prime_partial |
Blastp | CDP-diacylglycerol--serine O-phosphatidyltransferase 1 from Arabidopsis with 83.48% of identity |
---|---|
Blastx | CDP-diacylglycerol--serine O-phosphatidyltransferase 1 from Arabidopsis with 70.37% of identity |
Eggnog | Phosphatidylserine synthase(ENOG410XS7H) |
Kegg | Link to kegg annotations (AT1G15110) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452433.1) |
Pfam | Phosphatidyl serine synthase (PF03034.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer