Transcript | Ll_transcript_32542 |
---|---|
CDS coordinates | 504-1022 (+) |
Peptide sequence | MESNGHRRVKRPDYVKENGDFYLSNGDDEHDPWTAWAYKPHTITLLLIGACFLIWASGALDPERDASGDLVTTVKRGVWTMVAVFLAYCLLQAPSTVLIRPHPAIWRLVHGMAVVYLVALTFLLFQKRDDARQFMKFFHPDLGVELPERSYGADCRIYLADNPTSRFKNVYV* |
ORF Type | complete |
Blastp | CDP-diacylglycerol--serine O-phosphatidyltransferase 1 from Arabidopsis with 75.14% of identity |
---|---|
Blastx | CDP-diacylglycerol--serine O-phosphatidyltransferase 1 from Arabidopsis with 75.14% of identity |
Eggnog | Phosphatidylserine synthase(ENOG410XS7H) |
Kegg | Link to kegg annotations (AT1G15110) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441437.1) |
Pfam | Phosphatidyl serine synthase (PF03034.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer